PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_23984A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family LBD
Protein Properties Length: 359aa    MW: 38129.7 Da    PI: 7.377
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_23984AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26041.92.9e-1310017328101
                     DUF260  28 kkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallkeel 101
                                  f++v+++FG+s v++l++++   ++ed+++++ yeA a+   P +Ga+gv+++   +l+++ +el+++k+e+
  Oropetium_20150105_23984A 100 XXFKAVRRIFGVSAVCRLMRKVGWRRHEDLIRTVKYEATAWELYPASGAMGVVRDHVARLRSAYVELVSVKHEI 173
                                579*****************************************************************999875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS508919.46642173IPR004883Lateral organ boundaries, LOB
PfamPF031951.9E-10100170IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 359 aa     Download sequence    Send to blast
MADDGAPKTC SFDTLPTPEA TRTPAARPAA ADEATPTPHA SSVVEASPSA TSSSPPAAEE  60
ATTWSLXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XFKAVRRIFG VSAVCRLMRK  120
VGWRRHEDLI RTVKYEATAW ELYPASGAMG VVRDHVARLR SAYVELVSVK HEIQELVAAC  180
RGSDGPQQHT GEPLDDAAMP HAAAAATQND CIHPATRLPS AAGQHQTTAA QGAAVAHQLA  240
ASGSGGRQRT ELNLTMQQNA AAAATQSQYD PHGDGHPSQC QKTVNGARKR KQDFQNAADA  300
PASNSAVEEL AAAPLGSAHA GASVFQPQQP PPSPPQLGTA PRYRQELPSL PPSPWRTQ*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-